PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_008240987.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family NAC
Protein Properties Length: 440aa    MW: 50757.5 Da    PI: 7.0543
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_008240987.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM132.72.6e-41711981128
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.kkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevls 94 
                     lp G+rF Ptd elv+ yL+ kv +k+++  + + ++diy ++P+dL  + +  +e+ewyfF++r++ky++g+r+ r++ +g+Wkatgk +++ +
  XP_008240987.1  71 LPCGYRFAPTDVELVSSYLEGKVLNKEIPK-NRFLDLDIYLYHPRDLTgRITLMRESEWYFFTSRKRKYPRGQRPDRSAVDGFWKATGKAQDIED 164
                     699*************************99.6799************9444445788********************99**************** PP

             NAM  95 kkgelvglkktLvfykgrapkgektdWvmheyrl 128
                     ++g+++g k+tL fy+g+++++++t+W mhey+l
  XP_008240987.1 165 SNGKVIGSKRTLDFYQGNHQDSKRTEWKMHEYTL 198
                     ********************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019418.89E-4667226IPR003441NAC domain
PROSITE profilePS5100545.48771227IPR003441NAC domain
PfamPF023651.8E-2172198IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 440 aa     Download sequence    Send to blast
MDRNTNSPCS RLFTPAIFKY LPIKGFVILN LELRIRVITM EENNRFINDP IPDQVDMLIN  60
DPTNDAYFNS LPCGYRFAPT DVELVSSYLE GKVLNKEIPK NRFLDLDIYL YHPRDLTGRI  120
TLMRESEWYF FTSRKRKYPR GQRPDRSAVD GFWKATGKAQ DIEDSNGKVI GSKRTLDFYQ  180
GNHQDSKRTE WKMHEYTLDT ETAPRNEISN TRVTQLDNCV LCKIYNNSKG GNNDSSTIQS  240
DQRAEPSTNV EASQAFPDQQ IQPVHQHDQY LVGQSSGASS SSTANKRPRG MPTPTILNTY  300
VGNPTYYPHQ QYPFQNQTSG TPPGPVYNNY QNLTQYDQND QNLTQYDMQS ANIESHVQPR  360
ESFSSQPGFW LPMETSTYAD PMPLVDSSSM QLPVHIRLYE QLLAARNRDG DFAKRLERWY  420
HHQQQLFRQN PSSTPNCKLV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A7e-327022814169Stress-induced transcription factor NAC1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFM2535640.0FM253564.1 Prunus cerasifera BAC insert containing Ma gene, ma1 susceptible allele, clone 40K9.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008240987.10.0PREDICTED: NAC transcription factor NAM-A1-like
TrEMBLM5W9A70.0M5W9A7_PRUPE; Uncharacterized protein (Fragment)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF15078714
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G04070.21e-37NAC domain containing protein 47